LL-37 Research Peptide – Specifications, Testing & Procurement Guide
Selecting an LL-37 research peptide requires researchers to evaluate more than the compound name.
A complete procurement review should consider:
identity
sequence
quantity
purity
analytical testing
COA
batch documentation
price
and
availability
This helps separate scientific interest in LL-37 from the practical question of selecting a specific research product.
What Is the LL-37 Research Peptide?
LL-37 is the mature 37-residue peptide derived from the human cathelicidin precursor hCAP18.
The LL-37 sequence is:
[LL-37, 37 aa]
Its biological research history includes experimental investigation in innate immune and host-defense systems.
LL-37 Research Areas
LL-37 has been investigated in laboratory and preclinical research involving areas such as:
- Innate immunity
- Host-defense mechanisms
- Antimicrobial experimental systems
- Inflammatory signaling
- Cytokine-related pathways
- Epithelial biology
- Cellular responses
- Microbial interactions
- Nucleic-acid-associated immune mechanisms
These research areas shouldn’t be interpreted as established human therapeutic indications.
Browse LL-37 Research Products
https://peptideslabus.com/products?q=LL-37
Researchers can use the catalog to compare currently listed LL-37 products.
Review LL-37 5mg
https://peptideslabus.com/products/ll-37-5mg-research-peptide
The 5mg specification identifies the listed amount of research material.
It shouldn’t be confused with purity or molecular identity.
Review Additional LL-37 Listings
https://peptideslabus.com/products/crown-ll-37-research-peptide
https://peptideslabus.com/products/peptides-lab-ll37
Researchers should review each listing according to its current product specifications.
Specification 1: Molecular Identity
The first specification is:
What compound is being purchased?
For this cluster, the intended research compound is LL-37.
Researchers should verify that documentation consistently identifies the intended peptide.
Specification 2: Sequence
The peptide sequence provides a molecular reference point.
LL-37 contains 37 amino-acid residues.
Accurate sequence information helps distinguish LL-37 from related cathelicidin terminology.
Specification 3: Quantity
Researchers should determine the listed quantity of material.
For example:
5mg
describes a quantity specification.
It doesn’t mean “5mg purity” or provide identity information.
Specification 4: Purity
A reported purity percentage can provide information about sample composition within the context of the analytical method used.
Researchers should ask how that percentage was generated.
Specification 5: HPLC
HPLC is commonly used in peptide analysis.
It can provide chromatographic purity information.
Researchers should review the reported result and supporting analytical context where available.
Specification 6: Identity Testing
Chromatographic purity and molecular identity aren’t identical analytical questions.
Researchers should examine available identity-related testing separately.
Specification 7: COA
A Certificate of Analysis can bring several specifications together.
It may include:
- Product name
- Batch/lot
- Purity
- Analytical method
- Identity information
- Other analytical results
Researchers should review the actual document where available.
Specification 8: Batch Documentation
Analytical testing may apply to a particular batch.
Researchers should determine whether documentation corresponds to the material currently being considered.
Specification 9: Price
Current price should be checked directly through the live product listing.
Price should then be compared with:
- Quantity
- Testing
- Documentation
- Product configuration
Price alone doesn’t establish research-product quality.
Specification 10: Availability
Research inventory can change.
Use the live LL-37 catalog:
https://peptideslabus.com/products?q=LL-37
to review current listings.
LL-37 vs hCAP18
LL-37 and hCAP18 are closely related terms but shouldn’t be treated as identical molecular product names.
hCAP18 is the precursor.
LL-37 is the mature 37-residue C-terminal peptide.
Researchers should preserve this distinction when reviewing scientific literature and commercial products.
Research Evidence vs Commercial Specifications
A scientific paper may provide evidence about LL-37 behavior in an experimental model.
It doesn’t establish:
- Purity of a commercial product
- Product quantity
- Batch consistency
- Current price
- Current availability
These require product-specific information.
LL-37 Procurement Checklist
Before purchasing:
- Verify LL-37 identity.
- Review sequence information.
- Confirm product quantity.
- Review purity.
- Examine HPLC information.
- Review identity-related testing.
- Examine the COA.
- Check batch information.
- Compare current price.
- Confirm current availability.
- Match the product to experimental requirements.
- Avoid unsupported therapeutic interpretations.
Browse LL-37 Research Products
https://peptideslabus.com/products?q=LL-37
A strong LL-37 procurement decision combines molecular identity with analytical documentation and project-specific material requirements.
For laboratory research purposes only.
